DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4461 and HSP21

DIOPT Version :9

Sequence 1:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_194497.1 Gene:HSP21 / 828881 AraportID:AT4G27670 Length:227 Species:Arabidopsis thaliana


Alignment Length:136 Identity:22/136 - (16%)
Similarity:52/136 - (38%) Gaps:27/136 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LDELVSRRVRNQLIQSTP--YEWAHPMR---------------WDNYYSGERVHVDEKGFRIDID 103
            ||.|...|...|::.:..  :|...|:.               ||       :..:|...::..|
plant    86 LDPLSPMRTMRQMLDTMDRMFEDTMPVSGRNRGGSGVSEIRAPWD-------IKEEEHEIKMRFD 143

  Fly   104 VRQFHPHDIVVKTNDDYVIVQGNHNRR--DEGSNGLVERHFVRKYLLPRGYNANEVISDISSDGI 166
            :......|:.:...|:.::::|...:.  |:..:|.....:..:..||.....:::.::: .:|:
plant   144 MPGLSKEDVKISVEDNVLVIKGEQKKEDSDDSWSGRSVSSYGTRLQLPDNCEKDKIKAEL-KNGV 207

  Fly   167 LTIKAP 172
            |.|..|
plant   208 LFITIP 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 11/76 (14%)
HSP21NP_194497.1 IbpA 90..225 CDD:223149 19/132 (14%)
HSP20 130..227 CDD:278440 14/92 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.