DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4461 and ATHSP22.0

DIOPT Version :9

Sequence 1:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_192763.1 Gene:ATHSP22.0 / 826616 AraportID:AT4G10250 Length:195 Species:Arabidopsis thaliana


Alignment Length:173 Identity:36/173 - (20%)
Similarity:68/173 - (39%) Gaps:37/173 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 SRLW---WPSPHTSRSDLLRPLDELVSRRVRNQLIQSTPYEWAHPMRWDNYYSGERVHVDEKGFR 99
            |.||   :|.|       .:.|:.:.....|:..:..:|..    :.|.....|..:.:|..|.:
plant    39 SDLWLDRFPDP-------FKILERIPLGLERDTSVALSPAR----VDWKETAEGHEIMLDIPGLK 92

  Fly   100 IDIDVRQFHPHDIVVKTNDDYVIVQGNHNRRDEGSNG----LVER---HFVRKYLLPRGYNANEV 157
            .|         ::.::..::.|:......:|:|...|    .|||   .|.|::.||...:...|
plant    93 KD---------EVKIEVEENGVLRVSGERKREEEKKGDQWHRVERSYGKFWRQFKLPDNVDMESV 148

  Fly   158 ISDISSDGILTIKAPPPPPAKYYTPGERLVRV----HETGKLA 196
            .:.: .:|:|||......|.|  ..|.|:|.:    .:|.|::
plant   149 KAKL-ENGVLTINLTKLSPEK--VKGPRVVNIAAEEDQTAKIS 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 17/81 (21%)
ATHSP22.0NP_192763.1 IbpA 42..177 CDD:223149 32/157 (20%)
ACD_ScHsp26_like 72..163 CDD:107229 21/104 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.