DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4461 and AT2G29500

DIOPT Version :9

Sequence 1:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_180511.1 Gene:AT2G29500 / 817499 AraportID:AT2G29500 Length:153 Species:Arabidopsis thaliana


Alignment Length:181 Identity:39/181 - (21%)
Similarity:68/181 - (37%) Gaps:53/181 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLVPTTYRDLSRE--FDRLRPLYHPPYDFQLYPYLWDDSRLWWPSPHTSRSDLLRPLDELVSRR 63
            ||::|:.:.:..|.  ||               |:..|   :|.|....:.|.|.|....:|:.|
plant     1 MSMIPSFFNNNRRSNIFD---------------PFSLD---VWDPFKELTSSSLSRENSAIVNAR 47

  Fly    64 VRNQLIQSTPYEWAHPMRWDNYYSGERVHVDEKGFRIDIDVRQFHPHDIVVKTNDDYVI-VQGNH 127
            |          :|...         ...||    |:.|:.  .....::.|:..:|.|: :.|..
plant    48 V----------DWRET---------PEAHV----FKADLP--GLKKEEVKVEIEEDSVLKISGER 87

  Fly   128 NRRDEGSNGL---VER---HFVRKYLLPRGYNANEVISDISSDGILTIKAP 172
            :...|..|..   |||   .|.|::.||.....::|.:.: .:|:||:..|
plant    88 HVEKEDKNDTWHRVERSSGQFTRRFRLPENVKMDQVKAAM-ENGVLTVTVP 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 18/81 (22%)
AT2G29500NP_180511.1 ACD_ScHsp26_like 47..138 CDD:107229 25/117 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.