DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4461 and AT2G19310

DIOPT Version :9

Sequence 1:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_179521.1 Gene:AT2G19310 / 816448 AraportID:AT2G19310 Length:162 Species:Arabidopsis thaliana


Alignment Length:209 Identity:45/209 - (21%)
Similarity:71/209 - (33%) Gaps:66/209 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLVPTTYRDLSREFDRLRP---LYHPPYDFQLYPYLWDDSRLWWPSPHTSRS----DLLRPLDE 58
            ||::|.:.|      .||.|   ::.|   |:|.....|     :|||....|    .|.|.:..
plant     1 MSMIPISNR------RRLSPGDRIWEP---FELMNTFLD-----FPSPALFLSHHFPSLSREIFP 51

  Fly    59 LVSRRVRNQLIQSTPYEWAHPMRWDNYYSG---ERV--HVDEKGFRIDIDVRQFHPHDIVVKTND 118
            ..|....|..:..|....||..:  .|..|   :.|  .|||:|:             :.:.|.|
plant    52 QTSSSTVNTQLNWTETPTAHVFK--AYLPGVDQDEVIAFVDEEGY-------------LQICTGD 101

  Fly   119 DYVIVQGNHNRRDEGSNGLVERHFVRKYLLPRGYNANEVISDISSDGILTI---KAPPPPPAKYY 180
            :                     .|:.::.||.....::|.:.:..:.::..   .|...||....
plant   102 N---------------------KFMSRFKLPNNALTDQVTAWMEDEFLVVFVEKDASSSPPQLPE 145

  Fly   181 TPGERLVRVHE-TG 193
            ....|.|||.| ||
plant   146 IEENRNVRVVEITG 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 9/74 (12%)
AT2G19310NP_179521.1 alpha-crystallin-Hsps_p23-like 61..134 CDD:381838 16/108 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.