DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4461 and hspb6

DIOPT Version :9

Sequence 1:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001094428.1 Gene:hspb6 / 792610 ZFINID:ZDB-GENE-080214-7 Length:142 Species:Danio rerio


Alignment Length:158 Identity:45/158 - (28%)
Similarity:72/158 - (45%) Gaps:39/158 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FDRLRPLYHPPYDFQLYPYLWDDSRLWWPSPHTSRSDLLRPLDELVSRRVRNQLIQSTPYEWAHP 79
            ::|:.|...|..:..:.||.|                                    ||.|:..|
Zfish    16 WERVLPPLFPRLNGTIGPYSW------------------------------------TPTEFLIP 44

  Fly    80 MRWDNYYSGERVHVDEKGFRIDIDVRQFHPHDIVVKTNDDYVIVQGNHNRRDEGSNGLVERHFVR 144
            :  .......:|..|..||.:::||:.|.|.:::||.:.|||:|:|.|.::.:|| |||.|.|.|
Zfish    45 V--TEQTGASKVTCDHNGFTVEVDVKHFSPEELLVKVSGDYVVVEGKHEQKKDGS-GLVTRQFNR 106

  Fly   145 KYLLPRGYNANEVISDISSDGILTIKAP 172
            :|.:|.|.|...:.|.:|.:|:|.|.||
Zfish   107 RYRIPNGVNIMALESAMSPEGMLVISAP 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 31/74 (42%)
hspb6NP_001094428.1 metazoan_ACD 53..135 CDD:107247 35/83 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_132570
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X393
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.