DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4461 and hspb8

DIOPT Version :9

Sequence 1:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001094427.2 Gene:hspb8 / 791580 ZFINID:ZDB-GENE-030131-2480 Length:216 Species:Danio rerio


Alignment Length:172 Identity:46/172 - (26%)
Similarity:82/172 - (47%) Gaps:22/172 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DFQLYPYLWDDSRLW--WPSPHTSRSDLLRPLDELVSRRVRNQLIQSTPYEWAHPMRWDNYY--S 87
            ||.|.|:..:.|..|  |..|..|..     ||...:..:|:...:::   .:.|..:.:.|  |
Zfish    33 DFGLPPFPNELSMDWPGWARPRLSHR-----LDAPWTGSLRSGFPRAS---MSSPQGFSSVYTES 89

  Fly    88 GERVHV----DEKGFRIDIDVRQFHPHDIVVKTNDDYVIVQGNH-NRRDEGSNGLVERHFVRKYL 147
            ..|...    .::.:::.::|..|.|.::.|||.|.:|.|.|.| .::|||  |:|.::|.:|..
Zfish    90 PRRASAPPTDSDEPWKVCVNVHSFKPEELNVKTKDGFVEVSGKHEEKQDEG--GIVTKNFTKKIQ 152

  Fly   148 LPRGYNANEVISDISSDGILTIKAPPPPPAKYYT---PGERL 186
            :|...:...|.:.:|.:|:|.|:|...||...|:   |.|.:
Zfish   153 IPLDVDPVTVFASLSPEGVLIIEARQTPPYYLYSNEMPAESM 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 23/75 (31%)
hspb8NP_001094427.2 ACD_HspB8_like 88..178 CDD:107235 27/91 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.