DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4461 and Hspb3

DIOPT Version :9

Sequence 1:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_113938.1 Gene:Hspb3 / 78951 RGDID:68345 Length:152 Species:Rattus norvegicus


Alignment Length:82 Identity:28/82 - (34%)
Similarity:48/82 - (58%) Gaps:3/82 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 FRIDIDVRQFHPHDIVVKTNDDYVIVQGNH-NRRDEGSNGLVERHFVRKYLLPRGYNANEVISDI 161
            |:|.:||.||.|.||:::|.:.:::::..| .|.||  :|.:.|.|.|:|.||.|....::.:.:
  Rat    73 FQILLDVVQFLPEDIIIQTFEGWLLIKAQHGTRMDE--HGFISRSFTRQYKLPDGVETKDLSAIL 135

  Fly   162 SSDGILTIKAPPPPPAK 178
            ..||||.::...|...|
  Rat   136 CHDGILVVEVKDPLETK 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 26/71 (37%)
Hspb3NP_113938.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..69
ACD_HspB3_Like 65..147 CDD:107232 26/75 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.