DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4461 and hspb1

DIOPT Version :9

Sequence 1:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001072817.1 Gene:hspb1 / 780278 XenbaseID:XB-GENE-480320 Length:211 Species:Xenopus tropicalis


Alignment Length:207 Identity:56/207 - (27%)
Similarity:91/207 - (43%) Gaps:57/207 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YRDLSREFDRLRPLYHPPYDFQLYPYLWDDSRLWWPS-------------PHTSRSDLLRP-LDE 58
            |:..||.||:...:...|.|:    |.|..:.  ||.             |.|:.:....| .:.
 Frog    23 YQGTSRLFDQSFGMPRIPEDW----YQWPSTS--WPGYVRMLPSQSMEVVPPTTPAGATAPDFNR 81

  Fly    59 LVSRRVRNQL--IQSTPYEWAHPMRWDNYYSGERVHVDEKGFRIDIDVRQFHPHDIVVKTNDDYV 121
            .:||::.:.:  |:.|..:|                      :|.:||..|.|.::|:||.|..|
 Frog    82 ALSRQLSSGISEIRQTSDQW----------------------KISLDVNHFAPEELVIKTKDGIV 124

  Fly   122 IVQGNHNRRDEGSNGLVERHFVRKYLLPRGYNANEVISDISSDGILTIKAPPPPPAKYYTPGERL 186
            .:.|.|..:.: .:|.:.|.|.|||.||.|.:.|:|.|.:|.|||||::||.|.||         
 Frog   125 EITGKHEEKQD-EHGFISRCFTRKYTLPPGVDINKVASSLSPDGILTVEAPLPKPA--------- 179

  Fly   187 VRVHETGKLALP 198
               .::.::|:|
 Frog   180 ---IQSAEIAIP 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 29/74 (39%)
hspb1NP_001072817.1 ACD_HspB1_like 90..175 CDD:107230 34/107 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.