DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4461 and Hspb3

DIOPT Version :10

Sequence 1:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_064344.1 Gene:Hspb3 / 56534 MGIID:1928479 Length:154 Species:Mus musculus


Alignment Length:74 Identity:26/74 - (35%)
Similarity:46/74 - (62%) Gaps:3/74 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 FRIDIDVRQFHPHDIVVKTNDDYVIVQGNH-NRRDEGSNGLVERHFVRKYLLPRGYNANEVISDI 161
            |:|.:||.||.|.||:::|.:.:::::..| .|.||  :|.:.|.|.|:|.||.|....::.:.:
Mouse    75 FQILLDVVQFLPEDIIIQTFEGWLLIKAQHGTRMDE--HGFISRSFTRQYKLPDGVETKDLSAIL 137

  Fly   162 SSDGILTIK 170
            ..||||.::
Mouse   138 CHDGILVVE 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 26/71 (37%)
Hspb3NP_064344.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..71
ACD_HspB3_Like 67..149 CDD:107232 26/74 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.