powered by:
Protein Alignment CG4461 and Hspb3
DIOPT Version :9
Sequence 1: | NP_648304.1 |
Gene: | CG4461 / 39074 |
FlyBaseID: | FBgn0035982 |
Length: | 200 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_064344.1 |
Gene: | Hspb3 / 56534 |
MGIID: | 1928479 |
Length: | 154 |
Species: | Mus musculus |
Alignment Length: | 74 |
Identity: | 26/74 - (35%) |
Similarity: | 46/74 - (62%) |
Gaps: | 3/74 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 98 FRIDIDVRQFHPHDIVVKTNDDYVIVQGNH-NRRDEGSNGLVERHFVRKYLLPRGYNANEVISDI 161
|:|.:||.||.|.||:::|.:.:::::..| .|.|| :|.:.|.|.|:|.||.|....::.:.:
Mouse 75 FQILLDVVQFLPEDIIIQTFEGWLLIKAQHGTRMDE--HGFISRSFTRQYKLPDGVETKDLSAIL 137
Fly 162 SSDGILTIK 170
..||||.::
Mouse 138 CHDGILVVE 146
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3591 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1187096at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.820 |
|
Return to query results.
Submit another query.