DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4461 and ODF1

DIOPT Version :10

Sequence 1:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_077721.2 Gene:ODF1 / 4956 HGNCID:8113 Length:250 Species:Homo sapiens


Alignment Length:218 Identity:44/218 - (20%)
Similarity:72/218 - (33%) Gaps:65/218 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LVPTTYRDL---SREFDRLR-----------PLYHPPY---DFQLYPY------------LWD-- 36
            |:.:..||:   .||..:||           .||..||   |...|||            |.|  
Human     7 LLDSVRRDIKKVDRELRQLRCIDEFSTRCLCDLYMHPYCCCDLHPYPYCLCYSKRSRSCGLCDLY 71

  Fly    37 -----DSRLWW--PSPHTSRSDLLRPLD----ELVS-RRVRNQLIQSTPYEWAHPMRWDNYYSGE 89
                 |.:|:.  ||..:.....:|.::    ||.. ||..|:::.|:                 
Human    72 PCCLCDYKLYCLRPSLRSLERKAIRAIEDEKRELAKLRRTTNRILASS----------------- 119

  Fly    90 RVHVDEKGFRIDIDVRQFHPHDIVVKTNDDYVIVQGNHNRRDE--GSNGLVERHFVRKYLLPRGY 152
               .........::|..|.|..:.|:..|..|.|......|.:  ||......:..:::.||...
Human   120 ---CCSSNILGSVNVCGFEPDQVKVRVKDGKVCVSAERENRYDCLGSKKYSYMNICKEFSLPPCV 181

  Fly   153 NANEVISDISSDGILTIKAPPPP 175
            :..:|.........:.|::|..|
Human   182 DEKDVTYSYGLGSCVKIESPCYP 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 13/76 (17%)
ODF1NP_077721.2 2 X 5 AA repeats of [RC]-C-L-C-D 34..77 10/42 (24%)
ACD_HspB10 116..202 CDD:107237 15/105 (14%)
C-X-P repeat region 209..238
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.