powered by:
Protein Alignment CG4461 and hspb7
DIOPT Version :9
Sequence 1: | NP_648304.1 |
Gene: | CG4461 / 39074 |
FlyBaseID: | FBgn0035982 |
Length: | 200 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001006040.1 |
Gene: | hspb7 / 450019 |
ZFINID: | ZDB-GENE-041010-136 |
Length: | 161 |
Species: | Danio rerio |
Alignment Length: | 74 |
Identity: | 24/74 - (32%) |
Similarity: | 39/74 - (52%) |
Gaps: | 4/74 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 98 FRIDIDVRQFHPHDIVVKTNDDYVIVQGNHNRRDEGSNGLVERHFVRKYLLPRGYNANEVISDIS 162
::..:||:.|.|.|::|.|:::.:.| :.....|:|.|...|..|..||...:...|.|.:.
Zfish 73 YQFTVDVQDFSPEDVIVTTSNNQIEV----HAEKLASDGTVMNTFTHKCRLPEDVDPTSVKSSLG 133
Fly 163 SDGILTIKA 171
:||.|||||
Zfish 134 ADGTLTIKA 142
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.