DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4461 and Hsp27

DIOPT Version :9

Sequence 1:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001287001.1 Gene:Hsp27 / 39078 FlyBaseID:FBgn0001226 Length:213 Species:Drosophila melanogaster


Alignment Length:216 Identity:74/216 - (34%)
Similarity:117/216 - (54%) Gaps:42/216 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLVPTTYRDLSREFDRLRPLYHPPYDFQL-YPYLWDDSRLWWPSPHTSRSDLLRPLDELVSRRV 64
            ||::|..:  |:||.|         :|::. :.:|.:|...:....|    ||..|         
  Fly     1 MSIIPLLH--LARELD---------HDYRTDWGHLLEDDFGFGVHAH----DLFHP--------- 41

  Fly    65 RNQLIQST---------PYEWAH------PMRWDNYYSGERVHVDEKGFRIDIDVRQFHPHDIVV 114
            |..|:.:|         |||.:|      ..|.....:.....|.:.||::.:||.||.|:::.|
  Fly    42 RRLLLPNTLGLGRRRYSPYERSHGHHNQMSRRASGGPNALLPAVGKDGFQVCMDVSQFKPNELTV 106

  Fly   115 KTNDDYVIVQGNHNRRDEGSNGLVERHFVRKYLLPRGYNANEVISDISSDGILTIKAPPPPPAKY 179
            |..|:.|:|:|.|..|::| :|:::|||||||.||:|::.|||:|.:||||:||:|| ||||:|.
  Fly   107 KVVDNTVVVEGKHEEREDG-HGMIQRHFVRKYTLPKGFDPNEVVSTVSSDGVLTLKA-PPPPSKE 169

  Fly   180 YTPGERLVRVHETGKLALPWK 200
            ....||:|::.:||...|..|
  Fly   170 QAKSERIVQIQQTGPAHLSVK 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 36/74 (49%)
Hsp27NP_001287001.1 metazoan_ACD 86..163 CDD:107247 39/78 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 1 0.900 - - E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X393
87.970

Return to query results.
Submit another query.