DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4461 and Hsp67Bc

DIOPT Version :9

Sequence 1:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster


Alignment Length:124 Identity:39/124 - (31%)
Similarity:63/124 - (50%) Gaps:20/124 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 NYYSGERVHVDEKG-------FRIDIDVRQFHPHDIVVKTNDDYVIVQGNHNRRDEGSNGLVERH 141
            |..:||...:...|       |.:.:||..|.|.::.||..::.::|:|.|..| |..:|.|.||
  Fly    60 NKRNGELAALSRGGASNKQGNFEVHLDVGLFQPGELTVKLVNECIVVEGKHEER-EDDHGHVSRH 123

  Fly   142 FVRKYLLPRGYNANEVISDISSDGILTIKAPPPPPAKYYTPGERLVRVHETGKLALPWK 200
            |||:|.||:.::::.::|.:|.||:|.|..||            ||...|..:..:|.|
  Fly   124 FVRRYPLPKEFDSDAIVSTLSEDGVLNITVPP------------LVSKEELKERIIPIK 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 28/81 (35%)
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 28/79 (35%)
IbpA <79..170 CDD:223149 34/103 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 1 0.900 - - E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X393
87.970

Return to query results.
Submit another query.