DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4461 and CG7409

DIOPT Version :9

Sequence 1:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_648155.1 Gene:CG7409 / 38870 FlyBaseID:FBgn0035817 Length:154 Species:Drosophila melanogaster


Alignment Length:200 Identity:66/200 - (33%)
Similarity:91/200 - (45%) Gaps:61/200 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLVPTTYRDLSREFDRLRPLYHPPYDFQLYPY---LWDDSRLW----WPSPHTSRSDLLRPLDE 58
            |:|||.|...                |:..:.|   ||.|   |    |..|:..||        
  Fly     1 MALVPATNNT----------------DWDYWDYRRRLWRD---WDLNDWDLPYWKRS-------- 38

  Fly    59 LVSRRVRNQLIQSTPYEWAHPMRWDNYYSGERVHVDEKGFRIDIDVRQFHPHDIVVKTNDDYVIV 123
             :||      :.|.|             ...||.|.:.||..::||..|.|::|.|||:.|.|:|
  Fly    39 -LSR------VGSAP-------------DLSRVIVGKDGFEANVDVHLFKPYEISVKTSGDTVVV 83

  Fly   124 QGNHNRRDEGSNGLVERHFVRKYLLPRGYNANEVISDISSDGILTIKAPPPPPAKYYTPGERLVR 188
            :..|.:|.:|.. .|.||.|::::|||||..|:|.|::|||||||:|.||      |...||.|.
  Fly    84 EAKHEKRRDGDT-FVGRHIVKRFVLPRGYYPNDVRSELSSDGILTVKCPP------YLTNERSVY 141

  Fly   189 VHETG 193
            |.:.|
  Fly   142 VRQVG 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 34/74 (46%)
CG7409NP_648155.1 metazoan_ACD 54..131 CDD:107247 36/77 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 1 0.900 - - E1_KOG3591
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.