DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4461 and HSPB2

DIOPT Version :9

Sequence 1:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001532.1 Gene:HSPB2 / 3316 HGNCID:5247 Length:182 Species:Homo sapiens


Alignment Length:164 Identity:44/164 - (26%)
Similarity:68/164 - (41%) Gaps:37/164 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 PHTSRSDLLRPLDELVSRRVRNQLIQSTPYEWAHPMRWDNYY-------SGE-------RVHVDE 95
            |.|:..:...| ..|..:|....|:   |.|...|..:..||       :||       .:.:.|
Human    11 PATAEYEFANP-SRLGEQRFGEGLL---PEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLSE 71

  Fly    96 KGFRIDIDVRQFHPHDIVVKTNDDYVIVQGNHNRRDEGSNGLVERHFVRKYLLPRGYNANEVISD 160
            ..|:..:||..|.|.::.|:|.|:.:.|...|.:|.: .:|.|.|.|.|.|:||...:...|.:.
Human    72 GKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLD-RHGFVSREFCRTYVLPADVDPWRVRAA 135

  Fly   161 ISSDGILTIKAP------------------PPPP 176
            :|.||||.::||                  |.||
Human   136 LSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPP 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 26/74 (35%)
HSPB2NP_001532.1 alpha-crystallin-Hsps_p23-like 67..148 CDD:412199 27/81 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.