DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4461 and HSPB1

DIOPT Version :9

Sequence 1:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001531.1 Gene:HSPB1 / 3315 HGNCID:5246 Length:205 Species:Homo sapiens


Alignment Length:172 Identity:49/172 - (28%)
Similarity:70/172 - (40%) Gaps:49/172 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 WDDSRLWWPSPHTSRSDLLRPLDELVSRRVRNQLIQSTPYEWAHPM---RWDNY----------- 85
            ||..|.|:  ||:...|....|..|             |.||:..:   .|..|           
Human    16 WDPFRDWY--PHSRLFDQAFGLPRL-------------PEEWSQWLGGSSWPGYVRPLPPAAIES 65

  Fly    86 -------YS-----------GERVHVDEKGFRIDIDVRQFHPHDIVVKTNDDYVIVQGNHNRRDE 132
                   ||           .|..|..:: :|:.:||..|.|.::.|||.|..|.:.|.|..|.:
Human    66 PAVAAPAYSRALSRQLSSGVSEIRHTADR-WRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQD 129

  Fly   133 GSNGLVERHFVRKYLLPRGYNANEVISDISSDGILTIKAPPP 174
             .:|.:.|.|.|||.||.|.:..:|.|.:|.:|.||::||.|
Human   130 -EHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMP 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 27/74 (36%)
HSPB1NP_001531.1 Interaction with TGFB1I1. /evidence=ECO:0000250 70..205 35/103 (34%)
ACD_HspB1_like 84..169 CDD:107230 31/86 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.