DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4461 and cryaba

DIOPT Version :10

Sequence 1:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_571232.1 Gene:cryaba / 30393 ZFINID:ZDB-GENE-991119-2 Length:168 Species:Danio rerio


Alignment Length:151 Identity:50/151 - (33%)
Similarity:75/151 - (49%) Gaps:17/151 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PLYHPPYDFQLYPY-LWDDSRLWWPSPHTSRSDLLRPLDELVSRRVRNQLIQSTPYEWAHPMRWD 83
            |.|..|.....:|| ::|.    :...|.|.||...|...:...|         ||.|..|..||
Zfish     8 PWYRRPLFPGFFPYRIFDQ----YFGEHLSDSDPFSPFYTMFYYR---------PYLWRFPSWWD 59

  Fly    84 NYYSGERVHVDEKGFRIDIDVRQFHPHDIVVKTNDDYVIVQGNHNRRDEGSNGLVERHFVRKYLL 148
            :..|  .:..|...|.|::||:.|.|.::.||.|:|::.:.|.|:.|.: .:|:|.|.|.|||.:
Zfish    60 SGMS--EMRQDRDRFVINLDVKHFSPDELTVKVNEDFIEIHGKHDERQD-DHGIVAREFFRKYKI 121

  Fly   149 PRGYNANEVISDISSDGILTI 169
            |.|.:...:.|.:||||:|||
Zfish   122 PAGVDPGAITSSLSSDGVLTI 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 29/74 (39%)
cryabaNP_571232.1 Crystallin 1..53 CDD:425732 14/57 (25%)
alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins. 64..143 CDD:469641 31/80 (39%)

Return to query results.
Submit another query.