DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4461 and cryaba

DIOPT Version :9

Sequence 1:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_571232.1 Gene:cryaba / 30393 ZFINID:ZDB-GENE-991119-2 Length:168 Species:Danio rerio


Alignment Length:151 Identity:50/151 - (33%)
Similarity:75/151 - (49%) Gaps:17/151 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 PLYHPPYDFQLYPY-LWDDSRLWWPSPHTSRSDLLRPLDELVSRRVRNQLIQSTPYEWAHPMRWD 83
            |.|..|.....:|| ::|.    :...|.|.||...|...:...|         ||.|..|..||
Zfish     8 PWYRRPLFPGFFPYRIFDQ----YFGEHLSDSDPFSPFYTMFYYR---------PYLWRFPSWWD 59

  Fly    84 NYYSGERVHVDEKGFRIDIDVRQFHPHDIVVKTNDDYVIVQGNHNRRDEGSNGLVERHFVRKYLL 148
            :..|  .:..|...|.|::||:.|.|.::.||.|:|::.:.|.|:.|.: .:|:|.|.|.|||.:
Zfish    60 SGMS--EMRQDRDRFVINLDVKHFSPDELTVKVNEDFIEIHGKHDERQD-DHGIVAREFFRKYKI 121

  Fly   149 PRGYNANEVISDISSDGILTI 169
            |.|.:...:.|.:||||:|||
Zfish   122 PAGVDPGAITSSLSSDGVLTI 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 29/74 (39%)
cryabaNP_571232.1 Crystallin 1..49 CDD:278926 12/53 (23%)
IbpA 11..142 CDD:223149 46/146 (32%)
alpha-crystallin-Hsps_p23-like 64..143 CDD:294116 31/80 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X393
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.