DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4461 and Hspb7

DIOPT Version :9

Sequence 1:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_038896.2 Gene:Hspb7 / 29818 MGIID:1352494 Length:169 Species:Mus musculus


Alignment Length:127 Identity:34/127 - (26%)
Similarity:50/127 - (39%) Gaps:21/127 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 QSTPYEWAHPMRWDNYYSGERVHVDEKGF-----------------RIDIDVRQFHPHDIVVKTN 117
            |..|.|.|..|..|::.|....|.:...|                 ...:|:|.|.|.||:|.|.
Mouse    36 QDPPMEKALSMFSDDFGSFMLPHSEPLAFPARPGGQGNIKTLGDAYEFTVDMRDFSPEDIIVTTF 100

  Fly   118 DDYVIVQGNHNRRDEGSNGLVERHFVRKYLLPRGYNANEVISDISSDGILTIKAPPPPPAKY 179
            ::::.|:......|    |.|...|..|..||...:...|.|.:..||.|||:|...|..::
Mouse   101 NNHIEVRAEKLAAD----GTVMNTFAHKCQLPEDVDPTSVTSALREDGSLTIRARRHPHTEH 158

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 22/91 (24%)
Hspb7NP_038896.2 Required for localization to SC35 splicing speckles. /evidence=ECO:0000250 1..70 9/33 (27%)