DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4461 and HSPB8

DIOPT Version :9

Sequence 1:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_055180.1 Gene:HSPB8 / 26353 HGNCID:30171 Length:196 Species:Homo sapiens


Alignment Length:186 Identity:54/186 - (29%)
Similarity:81/186 - (43%) Gaps:34/186 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LSREFDRLRPLYHPPYD--FQLYPYLWDDSRLWWPS----------PHTSRSDLLRPLDELVSRR 63
            |.|:..|..||.....|  |.:.|:. ||....||.          |.|.||.:: |.....:.|
Human    16 LRRDPFRDSPLSSRLLDDGFGMDPFP-DDLTASWPDWALPRLSSAWPGTLRSGMV-PRGPTATAR 78

  Fly    64 VRNQLIQSTPYEWAHPMRWDNYYSGERVHVDEKGFRIDIDVRQFHPHDIVVKTNDDYVIVQGNHN 128
            .      ..|.|...|..    :.||       .:::.::|..|.|.:::|||.|.||.|.|.|.
Human    79 F------GVPAEGRTPPP----FPGE-------PWKVCVNVHSFKPEELMVKTKDGYVEVSGKHE 126

  Fly   129 RRDEGSNGLVERHFVRKYLLPRGYNANEVISDISSDGILTIKAPPPPPAKYYTPGE 184
            .:.: ..|:|.::|.:|..||...:...|.:.:|.:|:|.|:||..||  |.|.||
Human   127 EKQQ-EGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPP--YSTFGE 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 22/74 (30%)
HSPB8NP_055180.1 ACD_HspB8_like 80..170 CDD:107235 29/101 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..196 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.