DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4461 and Cryab

DIOPT Version :9

Sequence 1:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_037067.1 Gene:Cryab / 25420 RGDID:2414 Length:175 Species:Rattus norvegicus


Alignment Length:180 Identity:50/180 - (27%)
Similarity:79/180 - (43%) Gaps:18/180 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LYHPPYDFQLYPYLWDDSRLW--WPSPHTSRSDLLRPLDELVSRRVRNQLIQSTPYEWAHPMRW- 82
            ::||......:|: ...|||:  :...|...|||......|....:|       |..:.....| 
  Rat     5 IHHPWIRRPFFPF-HSPSRLFDQFFGEHLLESDLFSTATSLSPFYLR-------PPSFLRAPSWI 61

  Fly    83 DNYYSGERVHVDEKGFRIDIDVRQFHPHDIVVKTNDDYVIVQGNHNRRDEGSNGLVERHFVRKYL 147
            |...|..|:..|.  |.:::||:.|.|.::.||...|.:.|.|.|..|.: .:|.:.|.|.|||.
  Rat    62 DTGLSEMRMEKDR--FSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQD-EHGFISREFHRKYR 123

  Fly   148 LPRGYNANEVISDISSDGILTIKAPPPPPAKYYTPGERLVRVHETGKLAL 197
            :|...:...:.|.:||||:||:..    |.|..:..||.:.:....|.|:
  Rat   124 IPADVDPLTITSSLSSDGVLTVNG----PRKQASGPERTIPITREEKPAV 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 26/74 (35%)
CryabNP_037067.1 Crystallin 1..52 CDD:395419 12/54 (22%)
ACD_alphaB-crystallin_HspB5 67..150 CDD:107246 29/89 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 142..175 8/32 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X393
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.