DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4461 and SPCC338.06c

DIOPT Version :9

Sequence 1:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_588161.1 Gene:SPCC338.06c / 2538739 PomBaseID:SPCC338.06c Length:139 Species:Schizosaccharomyces pombe


Alignment Length:82 Identity:17/82 - (20%)
Similarity:35/82 - (42%) Gaps:8/82 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 EKGFRIDIDVRQFHPHDIVVKTNDDYVIVQGNHNRRDEGSNGLVER-------HFVRKYLLPRGY 152
            |....:|::|......::.|..:...:.:.|...:.:|...|.:.|       .|.|...||:..
pombe    42 EDTIEVDVEVPGIDKQNLKVDLHGSKLTISGERKKPEEEKAGPLIRWSERCVGAFSRTITLPQPV 106

  Fly   153 NANEVISDISSDGILTI 169
            : .::|....::|||:|
pombe   107 D-EKLIHASLNNGILSI 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 16/80 (20%)
SPCC338.06cNP_588161.1 IbpA 1..139 CDD:223149 17/82 (21%)
ACD_sHsps-like 37..126 CDD:107221 17/82 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.