DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4461 and Hspb1

DIOPT Version :9

Sequence 1:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_114176.4 Gene:Hspb1 / 24471 RGDID:61306 Length:206 Species:Rattus norvegicus


Alignment Length:193 Identity:51/193 - (26%)
Similarity:72/193 - (37%) Gaps:63/193 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YRDL----SREFDRLRPLYHPPYDFQLYPYLWDD--SRLWWPSPHTSRSDLLRPLDELV------ 60
            :||.    ||.||:       .:....:|..|..  |...||.       .:|||....      
  Rat    19 FRDWYPAHSRLFDQ-------AFGVPRFPDEWSQWFSSAGWPG-------YVRPLPAATAEGPAA 69

  Fly    61 --------SRRVRNQL------IQSTPYEWAHPMRWDNYYSGERVHVDEKGFRIDIDVRQFHPHD 111
                    ||.:..||      |:.|...|                      |:.:||..|.|.:
  Rat    70 VTLAAPAFSRALNRQLSSGVSEIRQTADRW----------------------RVSLDVNHFAPEE 112

  Fly   112 IVVKTNDDYVIVQGNHNRRDEGSNGLVERHFVRKYLLPRGYNANEVISDISSDGILTIKAPPP 174
            :.|||.:..|.:.|.|..|.: .:|.:.|.|.|||.||.|.:...|.|.:|.:|.||::||.|
  Rat   113 LTVKTKEGVVEITGKHEERQD-EHGYISRCFTRKYTLPPGVDPTLVSSSLSPEGTLTVEAPLP 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 26/74 (35%)
Hspb1NP_114176.4 Interaction with TGFB1I1. /evidence=ECO:0000269|PubMed:11546764 74..206 37/124 (30%)
ACD_HspB1_like 88..173 CDD:107230 31/107 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.