DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4461 and Cryaa

DIOPT Version :9

Sequence 1:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001276666.1 Gene:Cryaa / 24273 RGDID:2413 Length:196 Species:Rattus norvegicus


Alignment Length:161 Identity:46/161 - (28%)
Similarity:77/161 - (47%) Gaps:13/161 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SREFDRLRPLYHPPYDFQLYPYLWDDSRLWWPSPHTSRSDLLRPLDELVSRRVRNQLIQSTPYEW 76
            ||.||:.  .....:::.|.|:|  .|.:   ||:..:|.....||..:|     :|:....:..
  Rat    20 SRLFDQF--FGEGLFEYDLLPFL--SSTI---SPYYRQSLFRTVLDSGIS-----ELMTHMWFVM 72

  Fly    77 AHPMRWDNYYSGERVHVDEKGFRIDIDVRQFHPHDIVVKTNDDYVIVQGNHNRRDEGSNGLVERH 141
            ..|...:...:..:|..|...|.|.:||:.|.|.|:.||..:|:|.:.|.||.|.: .:|.:.|.
  Rat    73 HQPHAGNPKNNPGKVRSDRDKFVIFLDVKHFSPEDLTVKVLEDFVEIHGKHNERQD-DHGYISRE 136

  Fly   142 FVRKYLLPRGYNANEVISDISSDGILTIKAP 172
            |.|:|.||...:.:.:...:|:||:||...|
  Rat   137 FHRRYRLPSNVDQSALSCSLSADGMLTFSGP 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 27/74 (36%)
CryaaNP_001276666.1 Crystallin 1..51 CDD:395419 10/37 (27%)
alpha-crystallin-Hsps_p23-like 86..168 CDD:412199 30/83 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X393
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.