DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4461 and hsp-17

DIOPT Version :9

Sequence 1:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001023957.1 Gene:hsp-17 / 186113 WormBaseID:WBGene00002021 Length:149 Species:Caenorhabditis elegans


Alignment Length:100 Identity:36/100 - (36%)
Similarity:61/100 - (61%) Gaps:4/100 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 PYEWAHPMRWDNYYSGERVHV--DEKGFRIDIDVRQFHPHDIVVKTNDDYVIVQGNHNRRDEGSN 135
            || ||.......:..|:.:.|  :::.:.:.:||.||.|.::.|...|:.:|::|.||.:.: ..
 Worm    31 PY-WADQTMLTGHRVGDAIDVVNNDQEYNVSVDVSQFEPEELKVNIVDNQLIIEGKHNEKTD-KY 93

  Fly   136 GLVERHFVRKYLLPRGYNANEVISDISSDGILTIK 170
            |.|||||||||.||.|....::.|::|::|:||:|
 Worm    94 GQVERHFVRKYNLPTGVRPEQIKSELSNNGVLTVK 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 28/74 (38%)
hsp-17NP_001023957.1 metazoan_ACD 49..128 CDD:107247 30/79 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X393
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.