DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4461 and F08H9.3

DIOPT Version :9

Sequence 1:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_506585.1 Gene:F08H9.3 / 184214 WormBaseID:WBGene00008591 Length:147 Species:Caenorhabditis elegans


Alignment Length:84 Identity:19/84 - (22%)
Similarity:39/84 - (46%) Gaps:2/84 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 ERVHVDEKGFRIDIDVRQFHPHDIVVKTNDDYVIVQGNHNRRDEGSNGLVERHFVRKYLLPRGYN 153
            |.|...|| |.::::|....|.::.:......:.::..| :..|..|....:.:.:..:||...:
 Worm    43 EIVDTHEK-FSVNLNVPDVKPEELKINLEGRKLSIKAEH-QEIENDNISTTQTYSKSIVLPEDVD 105

  Fly   154 ANEVISDISSDGILTIKAP 172
            ...:.|::|.||.|.|:.|
 Worm   106 VTHLSSNLSEDGKLLIEVP 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 15/74 (20%)
F08H9.3NP_506585.1 metazoan_ACD 43..125 CDD:107247 19/84 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I3937
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.