DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4461 and hsp-43

DIOPT Version :9

Sequence 1:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001123107.2 Gene:hsp-43 / 180895 WormBaseID:WBGene00002024 Length:393 Species:Caenorhabditis elegans


Alignment Length:194 Identity:57/194 - (29%)
Similarity:86/194 - (44%) Gaps:41/194 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LW-DDSRLW---WPSPHTSRSDLLRPLD-------------ELVSRRVRNQL------IQSTPY- 74
            || ||.|.|   ||.|........|.:|             :.|..|..:||      .:|.|| 
 Worm    21 LWLDDFRDWPLDWPKPRDFFHRFSRDVDSWWKDWPTDWPRMDAVMPRFSSQLDRMDRNWRSDPYW 85

  Fly    75 -----EWAHPMRWDNYYSGERVHVDEKGFRIDIDVRQFHPHDIVVKTNDDYVIVQGNH-NRRDEG 133
                 .||.|:..:.......|..|::.|.:|:|..||.|.:|.|||.||.::::|.| :.||: 
 Worm    86 MNLYPRWAEPIFKEGIDVNSNVVNDDRRFAVDMDCYQFRPEEIQVKTLDDTLMIEGRHEDIRDK- 149

  Fly   134 SNGLVERHFVRKYLLPRGYNANEVISDISSDGILTIKAPPPPPAKYYTPG----ERLVRVHETG 193
             :...:.:|||||.|||..:.|.:.|.|.:.|.|.::|     .|:....    ||::.:...|
 Worm   150 -DNFTKMYFVRKYQLPRDVDFNSIQSSIDAKGRLQVEA-----GKFNNMALQGRERMIPIEGAG 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 30/75 (40%)
hsp-43NP_001123107.2 metazoan_ACD 107..186 CDD:107247 31/80 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.