DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4461 and hsp-25

DIOPT Version :9

Sequence 1:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001024374.1 Gene:hsp-25 / 180872 WormBaseID:WBGene00002023 Length:219 Species:Caenorhabditis elegans


Alignment Length:197 Identity:54/197 - (27%)
Similarity:83/197 - (42%) Gaps:51/197 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLVPTTYRDLSREFDRLRPLYHPPYDFQLYPY-LWDD---------------SRLWWPSPHTSR 49
            |..|....:.|..||:..||...||......|| .:.:               |.|..||.| ..
 Worm    45 MRRVEEEMKRLRSEFEGYRPNGGPPAAISNQPYNAYSNTSSHHETSNRTGGFGSPLPPPSFH-GP 108

  Fly    50 SDLL--RP-----LDELVSRRVRNQLIQSTPYEWAHPMRWDNYYSGERVHVDEKGFRIDIDVRQF 107
            |||:  ||     ||.|.|..::::                         .|.|..|:..||..:
 Worm   109 SDLMAHRPTYDPYLDNLKSPLIKDE-------------------------SDGKTLRLRFDVANY 148

  Fly   108 HPHDIVVKTNDDYVIVQGNHNRRDEGSNGLVERHFVRKYLLPRGYNANEVISDISSDGILTIKAP 172
            .|.::.|||.|:.::|...|  .::.....|.|.:.:::|||||.|..::.|.:|:||:||::||
 Worm   149 KPEEVTVKTIDNRLLVHAKH--EEKTPQRTVFREYNQEFLLPRGTNPEQISSTLSTDGVLTVEAP 211

  Fly   173 PP 174
            .|
 Worm   212 LP 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 25/74 (34%)
hsp-25NP_001024374.1 metazoan_ACD 131..212 CDD:107247 27/107 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.