DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4461 and hsp-16.48

DIOPT Version :9

Sequence 1:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_505355.1 Gene:hsp-16.48 / 179287 WormBaseID:WBGene00002019 Length:143 Species:Caenorhabditis elegans


Alignment Length:132 Identity:39/132 - (29%)
Similarity:64/132 - (48%) Gaps:14/132 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 SPHTSRSDLLRPLDELVSRRVRNQLIQSTPYEWAHPMRWDNYYS---GERVHVDEKGFRIDIDVR 105
            ||.:..:.|...|||:...      :| .|| |.:.......:|   ||.|: ||..|.:.:||.
 Worm     6 SPFSDSNVLDHFLDEITGS------VQ-FPY-WRNADHNSFNFSDNIGEIVN-DESKFSVQLDVS 61

  Fly   106 QFHPHDIVVKTNDDYVIVQGNHNRRDEGSNGLVERHFVRKYLLPRGYNANEVISDISSDGILTIK 170
            .|.|.|:.::.:...:.::|...::.|  :|..:|.|.:..|||...:...|.|.||::|.|.|:
 Worm    62 HFKPEDLKIELDGRELKIEGIQEKKSE--HGYSKRSFSKMILLPEDVDLTSVKSAISNEGKLQIE 124

  Fly   171 AP 172
            ||
 Worm   125 AP 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 22/74 (30%)
hsp-16.48NP_505355.1 IbpA <46..138 CDD:223149 27/84 (32%)
metazoan_ACD 46..127 CDD:107247 27/84 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I3937
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.