DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4461 and hsp-12.2

DIOPT Version :9

Sequence 1:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_498776.1 Gene:hsp-12.2 / 176148 WormBaseID:WBGene00002011 Length:110 Species:Caenorhabditis elegans


Alignment Length:96 Identity:28/96 - (29%)
Similarity:52/96 - (54%) Gaps:3/96 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 WAHPMRWDNYYSGERVHVDEKGFRIDIDVRQFHPHDIVVKTNDDYVIVQGNHNRRDEGSNGLVER 140
            |..|::.::  ...:||..::.|.:.:||:.|.|.:|.||.:...:::...|..|.: ::|.|.|
 Worm    14 WDWPLQHND--GVVKVHNTKEKFEVGLDVQFFTPKEIEVKVSGQELLIHCRHETRSD-NHGTVAR 75

  Fly   141 HFVRKYLLPRGYNANEVISDISSDGILTIKA 171
            ...|.|.||...:.:.|.|.:::.|:|||.|
 Worm    76 EINRAYKLPDDVDVSTVKSHLATRGVLTITA 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 21/74 (28%)
hsp-12.2NP_498776.1 metazoan_ACD 26..108 CDD:107247 26/82 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.