DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4461 and Hspb1

DIOPT Version :9

Sequence 1:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_038588.2 Gene:Hspb1 / 15507 MGIID:96240 Length:209 Species:Mus musculus


Alignment Length:197 Identity:53/197 - (26%)
Similarity:74/197 - (37%) Gaps:67/197 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FDRLR-PLYHP-----PYDFQLY------PYLWDDSRLW-----WPSPHTSRSDLLRPLDELV-- 60
            |..|| |.:.|     |...:|:      |.|.|:...|     ||.       .:|||....  
Mouse     8 FSLLRSPSWEPFRDWYPAHSRLFDQAFGVPRLPDEWSQWFSAAGWPG-------YVRPLPAATAE 65

  Fly    61 ------------SRRVRNQL------IQSTPYEWAHPMRWDNYYSGERVHVDEKGFRIDIDVRQF 107
                        ||.:..||      |:.|...|                      |:.:||..|
Mouse    66 GPAAVTLAAPAFSRALNRQLSSGVSEIRQTADRW----------------------RVSLDVNHF 108

  Fly   108 HPHDIVVKTNDDYVIVQGNHNRRDEGSNGLVERHFVRKYLLPRGYNANEVISDISSDGILTIKAP 172
            .|.::.|||.:..|.:.|.|..|.: .:|.:.|.|.|||.||.|.:...|.|.:|.:|.||::||
Mouse   109 APEELTVKTKEGVVEITGKHEERQD-EHGYISRCFTRKYTLPPGVDPTLVSSSLSPEGTLTVEAP 172

  Fly   173 PP 174
            .|
Mouse   173 LP 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 26/74 (35%)
Hspb1NP_038588.2 Interaction with TGFB1I1. /evidence=ECO:0000250 74..209 37/124 (30%)
ACD_HspB1_like 88..173 CDD:107230 31/107 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.