Sequence 1: | NP_648304.1 | Gene: | CG4461 / 39074 | FlyBaseID: | FBgn0035982 | Length: | 200 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_038588.2 | Gene: | Hspb1 / 15507 | MGIID: | 96240 | Length: | 209 | Species: | Mus musculus |
Alignment Length: | 197 | Identity: | 53/197 - (26%) |
---|---|---|---|
Similarity: | 74/197 - (37%) | Gaps: | 67/197 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 FDRLR-PLYHP-----PYDFQLY------PYLWDDSRLW-----WPSPHTSRSDLLRPLDELV-- 60
Fly 61 ------------SRRVRNQL------IQSTPYEWAHPMRWDNYYSGERVHVDEKGFRIDIDVRQF 107
Fly 108 HPHDIVVKTNDDYVIVQGNHNRRDEGSNGLVERHFVRKYLLPRGYNANEVISDISSDGILTIKAP 172
Fly 173 PP 174 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG4461 | NP_648304.1 | metazoan_ACD | 94..169 | CDD:107247 | 26/74 (35%) |
Hspb1 | NP_038588.2 | Interaction with TGFB1I1. /evidence=ECO:0000250 | 74..209 | 37/124 (30%) | |
ACD_HspB1_like | 88..173 | CDD:107230 | 31/107 (29%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3591 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1187096at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |