DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4461 and CRYAB

DIOPT Version :9

Sequence 1:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001276736.1 Gene:CRYAB / 1410 HGNCID:2389 Length:175 Species:Homo sapiens


Alignment Length:179 Identity:50/179 - (27%)
Similarity:79/179 - (44%) Gaps:16/179 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LYHPPYDFQLYPYLWDDSRLW--WPSPHTSRSDLLRPLDELVSRRVRNQLIQSTPYEWAHPMRWD 83
            ::||......:|: ...|||:  :...|...|||......|....:|.......| .|     :|
Human     5 IHHPWIRRPFFPF-HSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAP-SW-----FD 62

  Fly    84 NYYSGERVHVDEKGFRIDIDVRQFHPHDIVVKTNDDYVIVQGNHNRRDEGSNGLVERHFVRKYLL 148
            ...|..|:..|.  |.:::||:.|.|.::.||...|.:.|.|.|..|.: .:|.:.|.|.|||.:
Human    63 TGLSEMRLEKDR--FSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQD-EHGFISREFHRKYRI 124

  Fly   149 PRGYNANEVISDISSDGILTIKAPPPPPAKYYTPGERLVRVHETGKLAL 197
            |...:...:.|.:||||:||:..    |.|..:..||.:.:....|.|:
Human   125 PADVDPLTITSSLSSDGVLTVNG----PRKQVSGPERTIPITREEKPAV 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 26/74 (35%)
CRYABNP_001276736.1 Crystallin 1..52 CDD:395419 12/47 (26%)
ACD_alphaB-crystallin_HspB5 67..150 CDD:107246 29/89 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 146..175 6/28 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X393
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.