DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4461 and Hspb8

DIOPT Version :9

Sequence 1:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_446064.1 Gene:Hspb8 / 113906 RGDID:71003 Length:196 Species:Rattus norvegicus


Alignment Length:184 Identity:51/184 - (27%)
Similarity:82/184 - (44%) Gaps:43/184 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DSRLWWPSPHTS--RSDLLRPLDELVSRRVRNQLIQSTPY---------EWAHPMRWDNYYSG-- 88
            |.:|.:|..:.|  |.|..|  |..:|.|:.:......|:         |||.| |..:.:.|  
  Rat     3 DGQLPFPCSYPSRLRRDPFR--DSPLSSRLLDDGFGMDPFPDDLTAPWPEWALP-RLSSAWPGTL 64

  Fly    89 ------------ERVHVDEKG----------FRIDIDVRQFHPHDIVVKTNDDYVIVQGNHNRRD 131
                        .|..|..:|          :::.::|..|.|.:::|||.|.||.|.|.|..:.
  Rat    65 RSGMVPRGPTATARFGVPAEGRNPPPFPGEPWKVCVNVHSFKPEELMVKTKDGYVEVSGKHEEKQ 129

  Fly   132 EGSNGLVERHFVRKYLLPRGYNANEVISDISSDGILTIKAPPPPPAKYYTP-GE 184
            : ..|:|.::|.:|..||...:...|.:.:|.:|:|.|:||..||   |:| ||
  Rat   130 Q-EGGIVSKNFTKKIQLPAEVDPVTVFASLSPEGLLIIEAPQVPP---YSPFGE 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 23/84 (27%)
Hspb8NP_446064.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28 8/26 (31%)
ACD_HspB8_like 80..170 CDD:107235 26/90 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 176..196 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.