DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4461 and CRYAA2

DIOPT Version :9

Sequence 1:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_001300979.1 Gene:CRYAA2 / 102724652 -ID:- Length:173 Species:Homo sapiens


Alignment Length:177 Identity:52/177 - (29%)
Similarity:76/177 - (42%) Gaps:18/177 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 LYHPPYDFQLYPYLWDDSRLW--WPSPHTSRSDLLRPLDELVSRRVRNQLIQSTPYEWAHPMRWD 83
            :.||.:...|.|:.  .|||:  :........|||..|...:|...|..|.::.           
Human     5 IQHPWFKRTLGPFY--PSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTV----------- 56

  Fly    84 NYYSG-ERVHVDEKGFRIDIDVRQFHPHDIVVKTNDDYVIVQGNHNRRDEGSNGLVERHFVRKYL 147
             ..|| ..|..|...|.|.:||:.|.|.|:.||..||:|.:.|.||.|.: .:|.:.|.|.|:|.
Human    57 -LDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQD-DHGYISREFHRRYR 119

  Fly   148 LPRGYNANEVISDISSDGILTIKAPPPPPAKYYTPGERLVRVHETGK 194
            ||...:.:.:...:|:||:||...|........|..||.:.|....|
Human   120 LPSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEK 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 28/74 (38%)
CRYAA2NP_001300979.1 Crystallin 1..51 CDD:395419 13/47 (28%)
ACD_alphaA-crystallin_HspB4 60..145 CDD:107245 31/85 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X393
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.