| Sequence 1: | NP_648304.1 | Gene: | CG4461 / 39074 | FlyBaseID: | FBgn0035982 | Length: | 200 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_002932983.1 | Gene: | hspb2 / 100497635 | XenbaseID: | XB-GENE-940436 | Length: | 179 | Species: | Xenopus tropicalis |
| Alignment Length: | 142 | Identity: | 41/142 - (28%) |
|---|---|---|---|
| Similarity: | 65/142 - (45%) | Gaps: | 32/142 - (22%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 62 RRVRNQLIQSTPYEWAHPMR--------------------WDNYYSGERVHV-----------DE 95
Fly 96 KGFRIDIDVRQFHPHDIVVKTNDDYVIVQGNHNRRDEGSNGLVERHFVRKYLLPRGYNANEVISD 160
Fly 161 ISSDGILTIKAP 172 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG4461 | NP_648304.1 | metazoan_ACD | 94..169 | CDD:107247 | 28/74 (38%) |
| hspb2 | XP_002932983.1 | Crystallin | <21..51 | CDD:425732 | 3/29 (10%) |
| alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins. | 69..145 | CDD:469641 | 30/77 (39%) |