DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4461 and cryab

DIOPT Version :9

Sequence 1:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster
Sequence 2:XP_002932964.1 Gene:cryab / 100494321 XenbaseID:XB-GENE-971379 Length:173 Species:Xenopus tropicalis


Alignment Length:129 Identity:37/129 - (28%)
Similarity:67/129 - (51%) Gaps:8/129 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 TPYEWAHPM-RWDNYY-SG-ERVHVDEKGFRIDIDVRQFHPHDIVVKTNDDYVIVQGNHNRRDEG 133
            :|:.:.:|. |..|:. || ..:.:|:..|.:::||:.|.|.::.||...|::.:.|.|..|.: 
 Frog    44 SPFFFRYPFSRLPNWIDSGLSEMKIDKDRFSVNLDVKHFSPEELNVKVLGDFIEIHGTHEERQD- 107

  Fly   134 SNGLVERHFVRKYLLPRGYNANEVISDISSDGILTIKAPPPPPAKYYTPGERLVRVHETGKLAL 197
            .:|.|.|.|.|:|.:|...:...:.|.:|.||:||:..    |.|.....||.:.:....|:|:
 Frog   108 EHGYVSRDFQRRYKIPSDVDPQSITSTLSPDGVLTVSG----PRKVSEVPERCIPITREEKVAI 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 24/74 (32%)
cryabXP_002932964.1 Crystallin 1..51 CDD:366148 1/6 (17%)
alpha-crystallin-Hsps_p23-like 65..148 CDD:381838 26/87 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X393
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.