DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4461 and hspb6

DIOPT Version :9

Sequence 1:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster
Sequence 2:XP_002940672.2 Gene:hspb6 / 100494296 XenbaseID:XB-GENE-876273 Length:168 Species:Xenopus tropicalis


Alignment Length:121 Identity:35/121 - (28%)
Similarity:60/121 - (49%) Gaps:17/121 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 VRNQLIQSTPYEWAHPMRWDNYY-----------SG-ERVHVDEKGFRIDIDVRQFHPHDIVVKT 116
            :.::|..:.|.    ||....||           :| ..|.:|:..|.:.:||:.|.|.::.||.
 Frog    34 LESELFPAMPM----PMALSPYYYRSPSIPQPSEAGLSEVKLDKDQFSVLLDVKHFSPEELTVKV 94

  Fly   117 NDDYVIVQGNHNRRDEGSNGLVERHFVRKYLLPRGYNANEVISDISSDGILTIKAP 172
            ..|||.|...|..|.: .:|.:.|.|.|:|.:|...:...:.|.:|::|:|:|:||
 Frog    95 VGDYVEVHAKHEERPD-EHGFISREFHRRYKIPPTVSPAAISSALSAEGLLSIQAP 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 24/74 (32%)
hspb6XP_002940672.2 Crystallin 1..56 CDD:366148 6/25 (24%)
ACD_HspB4-5-6 68..149 CDD:107233 26/81 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X393
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.