DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4461 and LOC100489207

DIOPT Version :9

Sequence 1:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster
Sequence 2:XP_012822866.2 Gene:LOC100489207 / 100489207 -ID:- Length:206 Species:Xenopus tropicalis


Alignment Length:169 Identity:51/169 - (30%)
Similarity:74/169 - (43%) Gaps:36/169 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LYPYLWDDSRLWWPSPHTSRSDLLRP-----------LDELVSRRVRNQLIQ--STPYEWAHPMR 81
            |:..|.||..       :.|.|::|.           ..::..||:.:|..|  :|..|...|  
 Frog    25 LFGQLGDDIL-------SMRKDMVRRRQHVNEACELLFQDMDMRRITDQSRQPRATETEGTSP-- 80

  Fly    82 WDNYYSGERVHVDEKGFRIDIDVRQFHPHDIVVKTNDDYVIVQGNHNRRDEGSNGLV---ERHFV 143
                 |.::...|.  |.:.:||..|.||:|.|||....|||.|.|.|:.:..:|..   .|.:.
 Frog    81 -----SSDKDGKDH--FELMLDVGDFSPHEITVKTQGRRVIVTGKHERKSDSEDGSYVHEYREWN 138

  Fly   144 RKYLLPRGYNANEVISDISSDGILTIKAP----PPPPAK 178
            |:..||.|.|..:|:..:|.||.|.||||    ||.|.:
 Frog   139 RRAELPEGVNLEQVVCSLSKDGHLHIKAPWLALPPAPER 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 29/77 (38%)
LOC100489207XP_012822866.2 ACD_HspB9_like 82..167 CDD:107236 31/86 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.