DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4461 and hspb3

DIOPT Version :10

Sequence 1:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster
Sequence 2:XP_002941074.1 Gene:hspb3 / 100135387 XenbaseID:XB-GENE-969539 Length:145 Species:Xenopus tropicalis


Alignment Length:94 Identity:30/94 - (31%)
Similarity:51/94 - (54%) Gaps:5/94 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 HPMRWDNYYSGERVHVDEKGFRIDIDVRQFHPHDIVVKTNDDYVIVQGNHN-RRDEGSNGLVERH 141
            |..|.|.....::...|:  |::.:||.||.|.||:::..:.::|::|.|. |.||  :|.:.|.
 Frog    45 HKKREDGQLDDQQEEDDK--FKVLLDVVQFRPEDIIIQVFEGWLIIKGEHGCRMDE--HGFISRS 105

  Fly   142 FVRKYLLPRGYNANEVISDISSDGILTIK 170
            |.|.|.||.|....::.:....||||.::
 Frog   106 FTRTYQLPNGIGLTDLSAFFCHDGILAVE 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 27/75 (36%)
hspb3XP_002941074.1 alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins. 55..137 CDD:469641 27/84 (32%)

Return to query results.
Submit another query.