DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4461 and cryaa

DIOPT Version :9

Sequence 1:NP_648304.1 Gene:CG4461 / 39074 FlyBaseID:FBgn0035982 Length:200 Species:Drosophila melanogaster
Sequence 2:NP_694482.1 Gene:cryaa / 100000769 ZFINID:ZDB-GENE-020508-1 Length:173 Species:Danio rerio


Alignment Length:148 Identity:42/148 - (28%)
Similarity:68/148 - (45%) Gaps:33/148 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 YDFQLYPYLWDDSRLWWPSPHTSRSDLLRPLDELVSRRVRNQLIQSTPYEWAHPMRWDNYYSG-E 89
            :|:.|:|:.            ||          .||...|:.|.::.         .|:..|| .
Zfish    30 FDYDLFPFT------------TS----------TVSPYYRHSLFRNI---------LDSSNSGVS 63

  Fly    90 RVHVDEKGFRIDIDVRQFHPHDIVVKTNDDYVIVQGNHNRRDEGSNGLVERHFVRKYLLPRGYNA 154
            .|..|.:.|.:.:||:.|.|.::.||..||||.:||.|..|.: .:|.:.|.|.|:|.||...:.
Zfish    64 EVRSDREKFTVYLDVKHFSPDELSVKVTDDYVEIQGKHGERQD-DHGYISREFHRRYRLPSNVDQ 127

  Fly   155 NEVISDISSDGILTIKAP 172
            :.:...:|:||:||:..|
Zfish   128 SAITCTLSADGLLTLCGP 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4461NP_648304.1 metazoan_ACD 94..169 CDD:107247 27/74 (36%)
cryaaNP_694482.1 Crystallin 1..48 CDD:278926 7/39 (18%)
alpha-crystallin-Hsps_p23-like 61..146 CDD:294116 31/86 (36%)
IbpA <64..146 CDD:223149 30/83 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X393
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.