DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and ibpB

DIOPT Version :10

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_418141.2 Gene:ibpB / 948192 ECOCYCID:EG11535 Length:142 Species:Escherichia coli


Alignment Length:119 Identity:20/119 - (16%)
Similarity:48/119 - (40%) Gaps:24/119 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 ALSRGGAS----------NKQGNFEVHLDVGLFQPGELTVKLVNECIVVEGKHEEREDD-----H 117
            ||...|.|          :...::.:.|.:..|:..:|.::|....:.|:|..|:.:::     .
E. coli    22 ALQNAGESQSFPPYNIEKSDDNHYRITLALAGFRQEDLEIQLEGTRLSVKGTPEQPKEEKKWLHQ 86

  Fly   118 GHVSRHFVRRYPLPKEFDSDAIVSTLSEDGVLNITV------PPLVSKEELKER 165
            |.:::.|...:.|.:..:   :......:|:|:|.:      |....:..:.||
E. coli    87 GLMNQPFSLSFTLAENME---VSGATFVNGLLHIDLIRNEPEPIAAQRIAISER 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 14/99 (14%)
ibpBNP_418141.2 PRK11597 1..142 CDD:183223 20/119 (17%)

Return to query results.
Submit another query.