DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and AT1G59860

DIOPT Version :9

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_176195.1 Gene:AT1G59860 / 842280 AraportID:AT1G59860 Length:155 Species:Arabidopsis thaliana


Alignment Length:118 Identity:28/118 - (23%)
Similarity:60/118 - (50%) Gaps:20/118 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 SRGGASNKQGNFEVHLDVGLFQ---PG----ELTVKLVNECIV-VEGKH----EEREDDHGHVSR 122
            |....:|.:.:::...:..:|:   ||    |:.|::.::.:: :.|:.    ||::|....|.|
plant    39 SSSAIANARVDWKETAEAHVFKADLPGMKKEEVKVEIEDDSVLKISGERHVEKEEKQDTWHRVER 103

  Fly   123 H---FVRRYPLPKEFDSDAIVSTLSEDGVLNITVPPLVSKEELKERIIPIKHV 172
            .   |.|::.||:....|.:.::: |:|||.:|||    |.|..::...:|.:
plant   104 SSGGFSRKFRLPENVKMDQVKASM-ENGVLTVTVP----KVETNKKKAQVKSI 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 22/93 (24%)
IbpA <79..170 CDD:223149 25/105 (24%)
AT1G59860NP_176195.1 ACD_ScHsp26_like 47..138 CDD:107229 23/95 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.