DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and AT1G07400

DIOPT Version :9

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_172220.1 Gene:AT1G07400 / 837252 AraportID:AT1G07400 Length:157 Species:Arabidopsis thaliana


Alignment Length:114 Identity:30/114 - (26%)
Similarity:61/114 - (53%) Gaps:16/114 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 NGELAALSRGGASNKQGNFEVHL---DVGLFQPGELTVKLVNECIV-VEGKH----EEREDDHGH 119
            :||.:|::......|: ..|.|:   |:...:..|:.|::.::.:: :.|:.    ||::|....
plant    39 SGETSAITNARVDWKE-TAEAHVFKADLPGMKKEEVKVEIEDDSVLKISGERHVEKEEKQDTWHR 102

  Fly   120 VSR---HFVRRYPLPKEFDSDAIVSTLSEDGVLNITVPPLVSKEELKER 165
            |.|   .|.|::.||:....|.:.::: |:|||.:|||.:   ||.|::
plant   103 VERSSGQFSRKFKLPENVKMDQVKASM-ENGVLTVTVPKV---EEAKKK 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 22/89 (25%)
IbpA <79..170 CDD:223149 26/98 (27%)
AT1G07400NP_172220.1 ACD_ScHsp26_like 49..140 CDD:107229 23/92 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.