DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and AT5G37670

DIOPT Version :9

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_198583.1 Gene:AT5G37670 / 833746 AraportID:AT5G37670 Length:137 Species:Arabidopsis thaliana


Alignment Length:73 Identity:24/73 - (32%)
Similarity:34/73 - (46%) Gaps:11/73 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 EG-KHEEREDDHGHVSR---------HFVRRYPLPKEFDSDAIVSTLSEDGVLNITVPPLVSKEE 161
            || |.|::|:...||:.         .|:||..||:....|. |....|:|||.:.||...|.:.
plant    62 EGIKEEKKENLVWHVAEREAFSGGGSEFLRRIELPENVKVDQ-VKAYVENGVLTVVVPKDTSSKS 125

  Fly   162 LKERIIPI 169
            .|.|.:.|
plant   126 SKVRNVNI 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 18/56 (32%)
IbpA <79..170 CDD:223149 24/73 (33%)
AT5G37670NP_198583.1 ACD_ScHsp26_like 24..119 CDD:107229 19/57 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.