powered by:
Protein Alignment Hsp67Bc and AT5G37670
DIOPT Version :9
Sequence 1: | NP_523994.1 |
Gene: | Hsp67Bc / 39071 |
FlyBaseID: | FBgn0001229 |
Length: | 199 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_198583.1 |
Gene: | AT5G37670 / 833746 |
AraportID: | AT5G37670 |
Length: | 137 |
Species: | Arabidopsis thaliana |
Alignment Length: | 73 |
Identity: | 24/73 - (32%) |
Similarity: | 34/73 - (46%) |
Gaps: | 11/73 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 107 EG-KHEEREDDHGHVSR---------HFVRRYPLPKEFDSDAIVSTLSEDGVLNITVPPLVSKEE 161
|| |.|::|:...||:. .|:||..||:....|. |....|:|||.:.||...|.:.
plant 62 EGIKEEKKENLVWHVAEREAFSGGGSEFLRRIELPENVKVDQ-VKAYVENGVLTVVVPKDTSSKS 125
Fly 162 LKERIIPI 169
.|.|.:.|
plant 126 SKVRNVNI 133
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
1 |
1.000 |
51 |
1.000 |
Domainoid score |
I4315 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
56 |
1.000 |
Inparanoid score |
I2586 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1187096at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.970 |
|
Return to query results.
Submit another query.