DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and HSP17.6II

DIOPT Version :10

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_196763.1 Gene:HSP17.6II / 831075 AraportID:AT5G12020 Length:155 Species:Arabidopsis thaliana


Alignment Length:92 Identity:26/92 - (28%)
Similarity:45/92 - (48%) Gaps:14/92 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 PG----ELTVKLVNECIVVEGKHEEREDDHGHVSRH---------FVRRYPLPKEFDSDAIVSTL 143
            ||    |:.|::.|:.::|.....:||:......::         |:|::.||:..|.|.| |.:
plant    63 PGIKGDEIKVQVENDNVLVVSGERQRENKENEGVKYVRMERRMGKFMRKFQLPENADLDKI-SAV 126

  Fly   144 SEDGVLNITVPPLVSKEELKERIIPIK 170
            ..||||.:||..|...|..|.:.|.::
plant   127 CHDGVLKVTVQKLPPPEPKKPKTIQVQ 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 21/74 (28%)
HSP17.6IINP_196763.1 HSP20 48..136 CDD:459629 20/73 (27%)

Return to query results.
Submit another query.