DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and HSP21

DIOPT Version :9

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_194497.1 Gene:HSP21 / 828881 AraportID:AT4G27670 Length:227 Species:Arabidopsis thaliana


Alignment Length:115 Identity:22/115 - (19%)
Similarity:54/115 - (46%) Gaps:19/115 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 SRGGA-----------SNKQGNFEVHLDVGLFQPGELTVKLVNECIVVEGKHEEREDD---HGHV 120
            :|||:           ..::...::..|:......::.:.:.:..:|::|:.::.:.|   .|..
plant   116 NRGGSGVSEIRAPWDIKEEEHEIKMRFDMPGLSKEDVKISVEDNVLVIKGEQKKEDSDDSWSGRS 180

  Fly   121 SRHFVRRYPLPKEFDSDAIVSTLSEDGVLNITVPPLVSKEELKERIIPIK 170
            ...:..|..||...:.|.|.:.| ::|||.||:|    |.:::.::|.::
plant   181 VSSYGTRLQLPDNCEKDKIKAEL-KNGVLFITIP----KTKVERKVIDVQ 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 16/81 (20%)
IbpA <79..170 CDD:223149 19/93 (20%)
HSP21NP_194497.1 IbpA 90..225 CDD:223149 22/113 (19%)
HSP20 130..227 CDD:278440 19/101 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.