DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and HSP23.6-MITO

DIOPT Version :9

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_194250.1 Gene:HSP23.6-MITO / 828623 AraportID:AT4G25200 Length:210 Species:Arabidopsis thaliana


Alignment Length:159 Identity:42/159 - (26%)
Similarity:73/159 - (45%) Gaps:17/159 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 MYRRLHSRQHHDL--DLHTLGLIARMGAHAHHLVANKRNGELAALSRG-GASNKQGNFEV-HLDV 87
            :|||...|:..|.  |:.......|..:...:|:.......|.:.:|| |||..:..::: ..|.
plant    52 LYRRSVPRRRGDFFSDVFDPFSPTRSVSQVLNLMDQFMENPLLSATRGMGASGARRGWDIKEKDD 116

  Fly    88 GLF----QPG----ELTVKLVNECIVV--EGKHEEREDDHGHV-SRHFVRRYPLP-KEFDSDAIV 140
            .|:    .||    ::.:.|..:.:|:  |||:||...:.|.. :|.|..|..|| |.:..|.|.
plant   117 ALYLRIDMPGLSREDVKLALEQDTLVIRGEGKNEEDGGEEGESGNRRFTSRIGLPDKIYKIDEIK 181

  Fly   141 STLSEDGVLNITVPPLVSKEELKERIIPI 169
            :.: ::|||.:.:|.:..:|....|.|.|
plant   182 AEM-KNGVLKVVIPKMKEQERNDVRQIEI 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 24/91 (26%)
IbpA <79..170 CDD:223149 28/104 (27%)
HSP23.6-MITONP_194250.1 ACD_sHsps-like 110..195 CDD:107221 23/85 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.