DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and AT2G29500

DIOPT Version :9

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_180511.1 Gene:AT2G29500 / 817499 AraportID:AT2G29500 Length:153 Species:Arabidopsis thaliana


Alignment Length:90 Identity:27/90 - (30%)
Similarity:48/90 - (53%) Gaps:12/90 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 EVHL---DVGLFQPGELTVKLVNECIV-VEG-KHEERED--DHGH----VSRHFVRRYPLPKEFD 135
            |.|:   |:...:..|:.|::..:.:: :.| :|.|:||  |..|    .|..|.||:.||:...
plant    55 EAHVFKADLPGLKKEEVKVEIEEDSVLKISGERHVEKEDKNDTWHRVERSSGQFTRRFRLPENVK 119

  Fly   136 SDAIVSTLSEDGVLNITVPPLVSKE 160
            .|.:.:.: |:|||.:|||...:|:
plant   120 MDQVKAAM-ENGVLTVTVPKAETKK 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 24/82 (29%)
IbpA <79..170 CDD:223149 27/90 (30%)
AT2G29500NP_180511.1 ACD_ScHsp26_like 47..138 CDD:107229 25/83 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 51 1.000 Domainoid score I4315
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2586
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.