DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and AT2G19310

DIOPT Version :10

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_179521.1 Gene:AT2G19310 / 816448 AraportID:AT2G19310 Length:162 Species:Arabidopsis thaliana


Alignment Length:74 Identity:16/74 - (21%)
Similarity:31/74 - (41%) Gaps:13/74 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 DDHGHV-----SRHFVRRYPLPKEFDSDAIVSTLSEDGVLNITV-------PPLVSKEELKERII 167
            |:.|::     ...|:.|:.||....:|.:.:.: ||..|.:.|       ||.:.:.|....:.
plant    90 DEEGYLQICTGDNKFMSRFKLPNNALTDQVTAWM-EDEFLVVFVEKDASSSPPQLPEIEENRNVR 153

  Fly   168 PIKHVGPSD 176
            .::..|..|
plant   154 VVEITGDDD 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 11/50 (22%)
AT2G19310NP_179521.1 alpha-crystallin domain (ACD) found in alpha-crystallin-type small heat shock proteins, and a similar domain found in p23 (a cochaperone for Hsp90) and in other p23-like proteins. 61..134 CDD:469641 11/44 (25%)

Return to query results.
Submit another query.