DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and AT2G19310

DIOPT Version :9

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_179521.1 Gene:AT2G19310 / 816448 AraportID:AT2G19310 Length:162 Species:Arabidopsis thaliana


Alignment Length:74 Identity:16/74 - (21%)
Similarity:31/74 - (41%) Gaps:13/74 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 DDHGHV-----SRHFVRRYPLPKEFDSDAIVSTLSEDGVLNITV-------PPLVSKEELKERII 167
            |:.|::     ...|:.|:.||....:|.:.:.: ||..|.:.|       ||.:.:.|....:.
plant    90 DEEGYLQICTGDNKFMSRFKLPNNALTDQVTAWM-EDEFLVVFVEKDASSSPPQLPEIEENRNVR 153

  Fly   168 PIKHVGPSD 176
            .::..|..|
plant   154 VVEITGDDD 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 11/50 (22%)
IbpA <79..170 CDD:223149 14/66 (21%)
AT2G19310NP_179521.1 alpha-crystallin-Hsps_p23-like 61..134 CDD:381838 11/44 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.