DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and hspb6

DIOPT Version :9

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001094428.1 Gene:hspb6 / 792610 ZFINID:ZDB-GENE-080214-7 Length:142 Species:Danio rerio


Alignment Length:85 Identity:36/85 - (42%)
Similarity:51/85 - (60%) Gaps:3/85 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 GASN---KQGNFEVHLDVGLFQPGELTVKLVNECIVVEGKHEEREDDHGHVSRHFVRRYPLPKEF 134
            |||.   ....|.|.:||..|.|.||.||:..:.:|||||||:::|..|.|:|.|.|||.:|...
Zfish    50 GASKVTCDHNGFTVEVDVKHFSPEELLVKVSGDYVVVEGKHEQKKDGSGLVTRQFNRRYRIPNGV 114

  Fly   135 DSDAIVSTLSEDGVLNITVP 154
            :..|:.|.:|.:|:|.|:.|
Zfish   115 NIMALESAMSPEGMLVISAP 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 33/81 (41%)
IbpA <79..170 CDD:223149 33/76 (43%)
hspb6NP_001094428.1 metazoan_ACD 53..135 CDD:107247 33/82 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 1 1.000 - - FOG0000383
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45640
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X393
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.