DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hsp67Bc and Hspb3

DIOPT Version :9

Sequence 1:NP_523994.1 Gene:Hsp67Bc / 39071 FlyBaseID:FBgn0001229 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_113938.1 Gene:Hspb3 / 78951 RGDID:68345 Length:152 Species:Rattus norvegicus


Alignment Length:106 Identity:31/106 - (29%)
Similarity:55/106 - (51%) Gaps:7/106 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 KRNGELAALSRGGASNK------QGNFEVHLDVGLFQPGELTVKLVNECIVVEGKHEEREDDHGH 119
            |..|...||:....|.:      :..|::.|||..|.|.::.::.....::::.:|..|.|:||.
  Rat    47 KARGTPKALAEDSDSAETPPGEGKSRFQILLDVVQFLPEDIIIQTFEGWLLIKAQHGTRMDEHGF 111

  Fly   120 VSRHFVRRYPLPKEFDSDAIVSTLSEDGVLNITV-PPLVSK 159
            :||.|.|:|.||...::..:.:.|..||:|.:.| .||.:|
  Rat   112 ISRSFTRQYKLPDGVETKDLSAILCHDGILVVEVKDPLETK 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hsp67BcNP_523994.1 metazoan_ACD 75..154 CDD:107247 24/85 (28%)
IbpA <79..170 CDD:223149 26/82 (32%)
Hspb3NP_113938.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..69 4/20 (20%)
ACD_HspB3_Like 65..147 CDD:107232 23/81 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342776
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3591
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1187096at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.